GRK5 Antikörper

Produktnummer ABIN4951249

Produktdetails anti-GRK5 Antikörper

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GRK5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu GRK5

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Andere Bezeichnung: GRK5 (GRK5 Produkte)

Synonyme: GPRK5 antikoerper, Gprk5 antikoerper, si:dkey-171l20.1 antikoerper, GRK5 antikoerper, DKFZp468J1119 antikoerper, grk5 antikoerper, G protein-coupled receptor kinase 5 antikoerper, G protein-coupled receptor kinase 5 L homeolog antikoerper, GRK5 antikoerper, Grk5 antikoerper, grk5 antikoerper, grk5.L antikoerper

Hintergrund: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

UniProt: P34947

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling