-
- Target Alle GAL4 (LGALS4) Antikörper anzeigen
- GAL4 (LGALS4) (Galectin 4 (LGALS4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product LGALS4 Primärantikörper
-
anti-Galectin 4 (LGALS4) (AA 1-323) antibody
LGALS4 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 1-326) antibodyLGALS4 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 70-98), (N-Term) antibodyLGALS4 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB31354 unconjugated
anti-Galectin 4 (LGALS4) antibodyLGALS4 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (N-Term) antibodyLGALS4 Reaktivität: Human WB, IHC, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 1-100) antibodyLGALS4 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 19-324) antibodyLGALS4 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 1-323) antibodyLGALS4 Reaktivität: Human IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Galectin 4 (LGALS4) (AA 51-150) antibodyLGALS4 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 1E8 unconjugated
anti-Galectin 4 (LGALS4) (AA 51-151) antibodyLGALS4 Reaktivität: Human WB, IHC, ELISA, IHC (p) Wirt: Maus Monoclonal 1E8 unconjugated
-
- Applikationshinweise
- Optimal dilution of the GAL4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the GAL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- GAL4 (LGALS4) (Galectin 4 (LGALS4))
- Andere Bezeichnung
- GAL4 / Galectin-4 (LGALS4 Produkte)
- Synonyme
- LGALS4 antikoerper, gal4 antikoerper, l36lbp antikoerper, MGC86186 antikoerper, galectin-4 antikoerper, xgalectin-VIa antikoerper, gal-4 antikoerper, L36LBP antikoerper, L-36 antikoerper, L36LBI antikoerper, GAL4 antikoerper, galectin 4 antikoerper, lectin, galactoside-binding, soluble, 4 L homeolog antikoerper, Galectin-4 antikoerper, lectin, galactose binding, soluble 4 antikoerper, LGALS4 antikoerper, lgals4.L antikoerper, leg4 antikoerper, Lgals4 antikoerper
- Hintergrund
- Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.
- UniProt
- P56470
-
Sie sind hier:
