Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

FMR1 Antikörper

FMR1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN4951062
  • Target Alle FMR1 Antikörper anzeigen
    FMR1 (Fragile X Mental Retardation 1 (FMR1))
    Reaktivität
    • 70
    • 47
    • 36
    • 15
    • 6
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 58
    • 15
    • 2
    Kaninchen
    Klonalität
    • 51
    • 24
    Polyklonal
    Konjugat
    • 44
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser FMR1 Antikörper ist unkonjugiert
    Applikation
    • 68
    • 29
    • 18
    • 15
    • 14
    • 14
    • 10
    • 7
    • 5
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Aufreinigung
    Antigen affinity
    Immunogen
    Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.
    Isotyp
    IgG
    Top Product
    Discover our top product FMR1 Primärantikörper
  • Applikationshinweise
    Optimal dilution of the FMRP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Lagerung
    -20 °C
    Informationen zur Lagerung
    After reconstitution, the FMRP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    FMR1 (Fragile X Mental Retardation 1 (FMR1))
    Andere Bezeichnung
    FMRP / FMR1 (FMR1 Produkte)
    Synonyme
    AT24755 antikoerper, BcDNA:GM08679 antikoerper, CG6203 antikoerper, Dmel\\CG6203 antikoerper, EP(3)3517 antikoerper, FMR antikoerper, FMR1 antikoerper, FMRP antikoerper, FMRp antikoerper, FXR antikoerper, Fmrp antikoerper, cg6203 antikoerper, dFMR antikoerper, dFMR1 antikoerper, dFMRP antikoerper, dFXR antikoerper, dFXR1 antikoerper, dFXRP antikoerper, dFmr1 antikoerper, dFmrp antikoerper, dfmr antikoerper, dfmr1 antikoerper, dfxr antikoerper, dfxr1 antikoerper, dmfr1 antikoerper, fmr antikoerper, fmr1 antikoerper, FRAXA antikoerper, POF antikoerper, POF1 antikoerper, zFMR1 antikoerper, Fmr-1 antikoerper, CG6203 gene product from transcript CG6203-RC antikoerper, fragile X mental retardation 1 antikoerper, fragile X mental retardation syndrome 1 antikoerper, Fmr1 antikoerper, FMR1 antikoerper, fmr1 antikoerper
    Hintergrund
    FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
    UniProt
    Q06787
    Pathways
    Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
Sie sind hier:
Kundenservice