FMO2 Antikörper

Produktnummer ABIN4951058

Produktdetails anti-FMO2 Antikörper

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FMO2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FMO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu FMO2

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Andere Bezeichnung: FMO2 (FMO2 Produkte)

Synonyme: FMO 1B1 antikoerper, FMO 2 antikoerper, FMO1B1 antikoerper, 2310008D08Rik antikoerper, 2310042I22Rik antikoerper, AW107733 antikoerper, MGC68715 antikoerper, FMO4 antikoerper, FMO2 antikoerper, flavin containing monooxygenase 2 antikoerper, flavin containing monooxygenase 2 L homeolog antikoerper, FMO2 antikoerper, Fmo2 antikoerper, fmo2.L antikoerper

Hintergrund: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

UniProt: Q99518