FABP4 Antikörper

Produktnummer ABIN4950979

Produktdetails anti-FABP4 Antikörper

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4 were used as the immunogen for the FABP4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FABP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FABP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu FABP4

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Andere Bezeichnung: FABP4 (FABP4 Produkte)

Synonyme: A-FABP antikoerper, AFABP antikoerper, ALBP antikoerper, aP2 antikoerper, LOC100223994 antikoerper, FABP antikoerper, AP2 antikoerper, FABP3 antikoerper, FABP4 antikoerper, MGC84940 antikoerper, fabp4 antikoerper, 422/aP2 antikoerper, ALBP/Ap2 antikoerper, Ap2 antikoerper, Lbpl antikoerper, Albp antikoerper, fatty acid binding protein 4 antikoerper, fatty acid-binding protein, adipocyte antikoerper, fatty acid binding protein 4, adipocyte antikoerper, fatty acid binding protein 4, adipocyte L homeolog antikoerper, Fatty acid-binding protein, adipocyte antikoerper, adipocyte fatty acid-binding protein antikoerper, adipocyte fatty acid binding protein antikoerper, FABP4 antikoerper, LOC100223994 antikoerper, fabp4.L antikoerper, fabp4 antikoerper, Fabp4 antikoerper, LOC100732353 antikoerper, LOC100861279 antikoerper, LOC100057425 antikoerper, LOC395224 antikoerper

Hintergrund: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

UniProt: P15090

Pathways: Brown Fat Cell Differentiation