ERV3 Antikörper

Produktnummer ABIN4950951

Produktdetails anti-ERV3 Antikörper

Target: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERV3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ERV3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ERV3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ERV3

Target: ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))

Andere Bezeichnung: ERV3 / ERV3-1 (ERV3-1 Produkte)

Synonyme: ERV-R antikoerper, ERV3 antikoerper, ERVR antikoerper, HERV-R antikoerper, HERVR antikoerper, envR antikoerper, endogenous retrovirus group 3 member 1, envelope antikoerper, ERV3-1 antikoerper

Hintergrund: HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

UniProt: Q14264