EPH Receptor B1 Antikörper

Produktnummer ABIN4950927

Produktdetails anti-EPH Receptor B1 Antikörper

Target: EPH Receptor B1 (EPHB1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPH Receptor B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the EPHB1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the EPHB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu EPH Receptor B1

Target: EPH Receptor B1 (EPHB1)

Andere Bezeichnung: Eph Receptor B1 / EphB1 (EPHB1 Produkte)

Synonyme: ELK antikoerper, EPHT2 antikoerper, Hek6 antikoerper, NET antikoerper, ephb1-a antikoerper, xek antikoerper, Xek antikoerper, MGC89790 antikoerper, EPHB1 antikoerper, CEK6 antikoerper, EK6 antikoerper, 9330129L11 antikoerper, AW488255 antikoerper, C130099E04Rik antikoerper, Cek6 antikoerper, ENSMUSG00000074119 antikoerper, Elk antikoerper, Elkh antikoerper, Net antikoerper, Ephb2 antikoerper, Erk antikoerper, elk antikoerper, EPH receptor B1 antikoerper, EPH receptor B1 S homeolog antikoerper, ephrin type-B receptor 1 antikoerper, Eph receptor B1 antikoerper, EPHB1 antikoerper, ephb1.S antikoerper, ephb1 antikoerper, LOC100467687 antikoerper, Ephb1 antikoerper

Hintergrund: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

UniProt: P54762

Pathways: RTK Signalweg