Crossover junction endonuclease EME1 (EME1) Antikörper

Produktnummer ABIN4950913

Produktdetails

Target: Crossover junction endonuclease EME1 (EME1)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ of human EME1 were used as the immunogen for the EME1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the EME1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the EME1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Antigendetails

Target: Crossover junction endonuclease EME1 (EME1)

Andere Bezeichnung: EME1 (EME1 Produkte)

Synonyme: 6820428D13 antikoerper, essential meiotic structure-specific endonuclease 1 antikoerper, Eme1 antikoerper

Hintergrund: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.

UniProt: Q96AY2