CYP27B1 Antikörper

Produktnummer ABIN4950731

Produktdetails anti-CYP27B1 Antikörper

Target: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP27B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CYP27B1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CYP27B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CYP27B1

Target: CYP27B1 (Cytochrome P450, Family 27, Subfamily B, Polypeptide 1 (CYP27B1))

Andere Bezeichnung: CYP27B1 (CYP27B1 Produkte)

Synonyme: cp2b antikoerper, cyp1 antikoerper, cyp1alpha antikoerper, cyp27b antikoerper, p450c1 antikoerper, pddr antikoerper, vdd1 antikoerper, vddr antikoerper, vddri antikoerper, vdr antikoerper, CP2B antikoerper, CYP1 antikoerper, CYP1alpha antikoerper, CYP27B antikoerper, P450c1 antikoerper, PDDR antikoerper, VDD1 antikoerper, VDDR antikoerper, VDDRI antikoerper, VDR antikoerper, Cyp40 antikoerper, Cp2b antikoerper, Cyp1 antikoerper, Cyp27b antikoerper, Pddr antikoerper, Vdd1 antikoerper, Vddr antikoerper, VddrI antikoerper, Vdr antikoerper, cytochrome P450 family 27 subfamily B member 1 antikoerper, cytochrome P450, family 27, subfamily B, polypeptide 1 antikoerper, cytochrome P450, family 27, subfamily b, polypeptide 1 antikoerper, cyp27b1 antikoerper, CYP27B1 antikoerper, Cyp27b1 antikoerper

Hintergrund: CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

UniProt: O15528

Pathways: Metabolism of Steroid Hormones and Vitamin D