CRY2 Antikörper

Produktnummer ABIN4950666

Produktdetails anti-CRY2 Antikörper

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRY2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CRY2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CRY2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CRY2

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Andere Bezeichnung: CRY2 (CRY2 Produkte)

Synonyme: Cry2 antikoerper, Cry antikoerper, GB10211 antikoerper, CRY2 antikoerper, AT-PHH1 antikoerper, ATCRY2 antikoerper, CRYPTOCHROME 2 APOPROTEIN antikoerper, F19P19.14 antikoerper, F19P19_14 antikoerper, FHA antikoerper, PHH1 antikoerper, cryptochrome 2 antikoerper, HCRY2 antikoerper, PHLL2 antikoerper, AV006279 antikoerper, D130054K12Rik antikoerper, gCry2 antikoerper, cryptochrome circadian regulator 2 antikoerper, cryptochrome 2 antikoerper, cryptochrome Cry2 antikoerper, cryptochrome circadian clock 2 antikoerper, cryptochrome 2 (photolyase-like) antikoerper, CRY2 antikoerper, Cry2 antikoerper, cry2 antikoerper, LOC100502533 antikoerper

Hintergrund: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q49AN0

Pathways: Response to Water Deprivation, Protein targeting to Nucleus