EVI2A Antikörper (Ecotropic Viral Integration Site 2A) (C-Term)

Details for Product anti-EVI2A Antibody No. ABIN4892872, Anbieter: Anmelden zum Anzeigen
Antigen
  • EVDA
  • EVI-2A
  • EVI2
  • AW491894
  • Evi-2
  • Evi2
  • ecotropic viral integration site 2A
  • ecotropic viral integration site 2a
  • EVI2A
  • Evi2a
Epitop
C-Term
4
4
2
2
1
Reaktivität
Human
18
4
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
16
4
Klonalität
Polyklonal
Konjugat
Dieser EVI2A Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
14
11
7
4
4
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to EVI2A (ecotropic viral integration site 2A) The peptide sequence was selected from the C terminal of EVI2A. Peptide sequence LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere EVI2A products on genomics-online (e.g. as negative or positive controls)
Antigen
Andere Bezeichnung EVI2A (EVI2A Antibody Abstract)
Hintergrund Gene Symbol: EVI2A
Molekulargewicht Theoretical MW: 26 kDa
Gen-ID 2123
UniProt P22794
Applikations-hinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against EVI2A and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Ecotropic Viral Integration Site 2A (EVI2A) (C-Term) antibody (ABIN4892872) Western Blot: EVI2A Antibody [NBP1-68926] - ACHN cell lysate, concentration 0.2-1 ug/ml.
Haben Sie etwas anderes gesucht?