Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) Antikörper

Details zu Produkt Nr. ABIN4892768, Anbieter: Anmelden zum Anzeigen
Antigen
  • CYP8
  • CYP8A1
  • PGIS
  • PTGI
  • Cyp8
  • Cyp8a1
  • Pgis
  • ptgisl
  • PTGIS
  • prostaglandin I2 synthase
  • prostaglandin I2 (prostacyclin) synthase
  • prostacyclin synthase
  • PTGIS
  • Ptgis
  • ptgis
  • VDBG_06319
Reaktivität
Human
63
32
12
11
4
4
3
3
3
3
3
2
2
1
1
Wirt
Kaninchen
52
12
3
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
47
21
18
14
13
9
3
2
2
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS.
Reinigung Immunogen affinity purified
Antigen
Andere Bezeichnung Prostaglandin I2 Synthase (PTGIS Antibody Abstract)
Hintergrund Gene Symbol: PTGIS
Molekulargewicht Theoretical MW: 57 kDa
Gen-ID 5740
UniProt Q16647
Applikations-hinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against PTGIS and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) antibody (ABIN4892768) Western Blot: PTGIS Antibody [NBP1-62390] - Human Brain lysate, concentration 0.2-1 u...
Haben Sie etwas anderes gesucht?