F-Box Protein 25 (FBXO25) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4890490, Anbieter: Anmelden zum Anzeigen
Antigen
  • FBXO25
  • fbxo32
  • MGC108443
  • DKFZp469H2437
  • zgc:100907
  • FBX25
  • 9130015I06Rik
  • AI649137
  • Fbx25
  • F-box protein 25
  • F-box protein 25 L homeolog
  • FBXO25
  • fbxo25
  • fbxo25.L
  • Fbxo25
Epitop
N-Term
4
4
3
2
1
1
1
Reaktivität
Human
34
19
17
5
5
4
3
3
2
2
2
1
1
Wirt
Kaninchen
30
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
19
13
10
6
6
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the N terminal of FBXO25. Peptide sequence LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL.
Reinigung Immunogen affinity purified
Antigen
Andere Bezeichnung FBXO25 (FBXO25 Antibody Abstract)
Hintergrund Gene Symbol: FBXO25
Molekulargewicht Theoretical MW: 34 kDa
Gen-ID 26260
UniProt Q8TCJ0
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against FBXO25 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-F-Box Protein 25 (FBXO25) (N-Term) antibody (ABIN4890490) Western Blot: FBXO25 Antibody [NBP1-55044] - Human Heart lysate, concentration 0.2-1 ...
Haben Sie etwas anderes gesucht?