SUB1 Antikörper (C-Term)

Produktnummer ABIN4886733

Produktdetails anti-SUB1 Antikörper

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Bindungsspezifität: AA 96-127, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Activated RNA polymerase II transcriptional coactivator p15(SUB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: MKPGRKGISL NPEQWSQLKE QISDIDDAVR KL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Activated RNA polymerase II transcriptional coactivator p15(SUB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: SUB1 homolog, transcriptional regulator
Protein Name: Activated RNA polymerase II transcriptional coactivator p15

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SUB1

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Andere Bezeichnung: SUB1 (SUB1 Produkte)

Synonyme: P15 antikoerper, PC4 antikoerper, p14 antikoerper, AI842364 antikoerper, P9 antikoerper, Pc4 antikoerper, Rpo2tc1 antikoerper, SUB1 homolog, transcriptional regulator antikoerper, SUB1 homolog (S. cerevisiae) antikoerper, SUB1 antikoerper, Sub1 antikoerper

Hintergrund: Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

Synonyms: p14 | P15 | PC4 | PC4 LSB | Positive cofactor 4 | RPO2TC1 | Sub1 | P53999

Gen-ID: 10923

UniProt: P53999