PSMA3 Antikörper (Middle Region)

Produktnummer ABIN4886706

Produktdetails anti-PSMA3 Antikörper

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Bindungsspezifität: AA 88-127, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: LADIAREEAS NFRSNFGYNI PLKHLADRVA MYVHAYTLYS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 3
Protein Name: Proteasome subunit alpha type-3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PSMA3

Target: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Andere Bezeichnung: PSMA3 (PSMA3 Produkte)

Synonyme: HC8 antikoerper, PSC3 antikoerper, Psma3l antikoerper, psma3 antikoerper, im:6909944 antikoerper, zgc:114044 antikoerper, Lmpc8 antikoerper, proteasome subunit alpha 3 antikoerper, proteasome subunit alpha 3 L homeolog antikoerper, proteasome (prosome, macropain) subunit, alpha type 3 antikoerper, PSMA3 antikoerper, Psma3 antikoerper, psma3.L antikoerper, psma3 antikoerper

Hintergrund: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Synonyms: HC8 | Macropain subunit C8 | PSC8 | psmA3 | P25788

Gen-ID: 5684

UniProt: P25788

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA