PLIN3 Antikörper (C-Term)

Produktnummer ABIN4886698

Produktdetails anti-PLIN3 Antikörper

Target: PLIN3 (Perilipin 3 (PLIN3))

Bindungsspezifität: AA 323-365, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLIN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ESRALTMFRD IAQQLQATCT SLGSSIQGLP TNVKDQVQQA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: perilipin 3
Protein Name: Perilipin-3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PLIN3

Target: PLIN3 (Perilipin 3 (PLIN3))

Andere Bezeichnung: PLIN3 (PLIN3 Produkte)

Synonyme: 1300012C15Rik antikoerper, M6prbp1 antikoerper, Tip47 antikoerper, M6PRBP1 antikoerper, PP17 antikoerper, TIP47 antikoerper, fl05f04 antikoerper, wu:fl05f04 antikoerper, m6prbp1 antikoerper, MGC80328 antikoerper, PLIN3 antikoerper, pp17 antikoerper, tip47 antikoerper, MGC53750 antikoerper, perilipin 3 antikoerper, si:rp71-61h23.4 antikoerper, perilipin 3 S homeolog antikoerper, perilipin 3 L homeolog antikoerper, Plin3 antikoerper, PLIN3 antikoerper, si:rp71-61h23.4 antikoerper, plin3.S antikoerper, plin3.L antikoerper

Hintergrund: Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: M6PRBP 1 | M6PRBP1 | Perilipin 3 | Perilipin3 | Perilipin-3 | PLIN3 | pp17 | Placental protein 17 | TIP47 | O60664

Gen-ID: 10226

UniProt: O60664