MPP1 Antikörper (C-Term)
-
- Target Alle MPP1 Antikörper anzeigen
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
-
Bindungsspezifität
- AA 409-450, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- TEALQQLQKD SEAIRSQYAH YFDLSLVNNG VDETLKKLQE AF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: membrane palmitoylated protein 1
Protein Name: 55 kDa erythrocyte membrane protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF), different from the related mouse sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product MPP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
- Andere Bezeichnung
- MPP1 (MPP1 Produkte)
- Synonyme
- AAG12 antikoerper, DXS552E antikoerper, EMP55 antikoerper, MRG1 antikoerper, PEMP antikoerper, MGC53500 antikoerper, MGC89895 antikoerper, MPP1 antikoerper, p55 antikoerper, cb997 antikoerper, zgc:77039 antikoerper, wu:fc85f03 antikoerper, 55kDa antikoerper, C130070C03Rik antikoerper, membrane palmitoylated protein 1 antikoerper, membrane protein, palmitoylated 1 L homeolog antikoerper, membrane protein, palmitoylated 1 antikoerper, membrane protein, palmitoylated antikoerper, MPP1 antikoerper, mpp1.L antikoerper, mpp1 antikoerper, Mpp1 antikoerper
- Hintergrund
-
55 kDa erythrocyte membrane protein is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: AAG 12 | AAG12 | DXS552 | DXS552E | EMP 55 | EMP55 | MPP 1 | MPP1 | MRG 1 | MRG1 | p55 | palmitoylated 1 | PEMP | Q00013 - Gen-ID
- 4354
- UniProt
- Q00013
-