GAL4 Antikörper (C-Term)

Produktnummer ABIN4886660

Produktdetails anti-GAL4 Antikörper

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Bindungsspezifität: AA 283-320, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.

Sequenz: DRFKVYANGQ HLFDFAHRLS AFQRVDTLEI QGDVTLSY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.
Gene Name: lectin, galactoside binding soluble 4
Protein Name: Galectin-4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu GAL4

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Andere Bezeichnung: LGALS4 (LGALS4 Produkte)

Synonyme: LGALS4 antikoerper, gal4 antikoerper, l36lbp antikoerper, MGC86186 antikoerper, galectin-4 antikoerper, xgalectin-VIa antikoerper, gal-4 antikoerper, L36LBP antikoerper, L-36 antikoerper, L36LBI antikoerper, GAL4 antikoerper, galectin 4 antikoerper, lectin, galactoside-binding, soluble, 4 L homeolog antikoerper, Galectin-4 antikoerper, lectin, galactose binding, soluble 4 antikoerper, LGALS4 antikoerper, lgals4.L antikoerper, leg4 antikoerper, Lgals4 antikoerper

Hintergrund: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

Synonyms: Antigen NY CO 27 | Antigen NY-CO-27 | Antigen NYCO27 | GAL 4 | Gal-4 | GAL4 | Galectin 4 | Galectin-4 | Galectin -4 | L36LBP | LGALS4 | P56470

Gen-ID: 3960

UniProt: P56470