ARHGEF1 Antikörper (N-Term)

Produktnummer ABIN4886475

Produktdetails anti-ARHGEF1 Antikörper

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Bindungsspezifität: AA 41-71, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGEF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EQNSQFQSLE QVKRRPAHLM ALLQHVALQF E

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Rho guanine nucleotide exchange factor 1
Protein Name: Rho guanine nucleotide exchange factor 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ARHGEF1

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Andere Bezeichnung: ARHGEF1 (ARHGEF1 Produkte)

Synonyme: arhgef1 antikoerper, cb473 antikoerper, zgc:158261 antikoerper, ARHGEF1 antikoerper, GEF1 antikoerper, LBCL2 antikoerper, LSC antikoerper, P115-RHOGEF antikoerper, SUB1.5 antikoerper, Lbcl2 antikoerper, Lsc antikoerper, Rho guanine nucleotide exchange factor (GEF) 1a antikoerper, Rho guanine nucleotide exchange factor 1 antikoerper, Rho guanine nucleotide exchange factor (GEF) 1 antikoerper, arhgef1a antikoerper, ARHGEF1 antikoerper, arhgef1 antikoerper, Arhgef1 antikoerper

Hintergrund: Rho guanine nucleotide exchange factor 1 is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Synonyms: ARHGEF 1 | ARHGEF1 | GEF 1 | GEF1 | LBCL 2 | LBCL2 | LSC | p115 RhoGEF | p115-RhoGEF | p115RhoGEF | Q92888

Gen-ID: 9138

UniProt: Q92888

Pathways: Neurotrophin Signalübertragung, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling