AP2M1 Antikörper (C-Term)

Produktnummer ABIN4886462

Produktdetails anti-AP2M1 Antikörper

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Bindungsspezifität: AA 399-435, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP2M1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: LKVRYLKVFE PKLNYSDHDV IKWVRYIGRS GIYETRC

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adaptor related protein complex 2 mu 1 subunit
Protein Name: AP-2 complex subunit mu

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu AP2M1

Target: AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))

Andere Bezeichnung: AP2M1 (AP2M1 Produkte)

Synonyme: AP50 antikoerper, CLAPM1 antikoerper, mu2 antikoerper, Ap50 antikoerper, Clapm1 antikoerper, cb34 antikoerper, Ap2m1 antikoerper, dpy-23 antikoerper, sb:cb34 antikoerper, zgc:55711 antikoerper, zgc:85653 antikoerper, wu:fa97a10 antikoerper, ap2m1-a antikoerper, ap2m1 antikoerper, zgc:56643 antikoerper, AP2M1 antikoerper, adaptor related protein complex 2 mu 1 subunit antikoerper, adaptor-related protein complex 2, mu 1 subunit antikoerper, adaptor-related protein complex 2, mu 1 subunit, a antikoerper, adaptor related protein complex 2 mu 1 subunit L homeolog antikoerper, adaptor-related protein complex 2, mu 1 subunit, b antikoerper, AP-2 complex subunit mu-1 antikoerper, clathrin coat assembly protein AP50 antikoerper, clathrin coat assembly protein ap50 antikoerper, AP2M1 antikoerper, Ap2m1 antikoerper, ap2m1a antikoerper, ap2m1.L antikoerper, ap2m1b antikoerper, ap2m1 antikoerper, cgd8_950 antikoerper, PY06523 antikoerper, PVX_118455 antikoerper, PVX_123590 antikoerper, CpipJ_CPIJ003697 antikoerper

Hintergrund: AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.

Synonyms: Adaptin mu 1 | Adaptin-mu2 | AP 2 mu 2 chain | AP-2 complex subunit mu | Ap2m1 | AP50 | CLAPM1 | Q96CW1

Gen-ID: 1173

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, EGFR Downregulation, SARS-CoV-2 Protein Interaktom