ABCB10 Antikörper (C-Term)

Produktnummer ABIN4886409

Produktdetails anti-ABCB10 Antikörper

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Bindungsspezifität: AA 640-678, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCB10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.

Sequenz: QRIAIARALL KNPKILLLDE ATSALDAENE YLVQEALDR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.
Gene Name: ATP binding cassette subfamily B member 10
Protein Name: ATP-binding cassette sub-family B member 10, mitochondrial

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ABCB10

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Andere Bezeichnung: ABCB10 (ABCB10 Produkte)

Synonyme: EST20237 antikoerper, M-ABC2 antikoerper, MTABC2 antikoerper, Abc-me antikoerper, Abcb12 antikoerper, ABCB10 antikoerper, si:dkey-162b3.3 antikoerper, GB10581 antikoerper, ATP binding cassette subfamily B member 10 antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 10 antikoerper, ATP-binding cassette sub-family B member 10, mitochondrial antikoerper, ABCB10 antikoerper, Abcb10 antikoerper, abcb10 antikoerper, LOC552744 antikoerper

Hintergrund: ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Synonyms: ABC transporter 10 protein | ABCB10 | EST20237 | M ABC2 | M-ABC2 | MTABC2 | Q9NRK6

Gen-ID: 23456