UGGT1 Antikörper (UDP-Glucose Glycoprotein Glucosyltransferase 1)

Details for Product anti-UGGT1 Antibody No. ABIN4364281, Anbieter: Anmelden zum Anzeigen
Antigen
  • UGCGL1
  • ugcgl1
  • uggt2
  • 0910001L17Rik
  • A930007H10Rik
  • AA589501
  • AI414429
  • AI448372
  • C820010P03Rik
  • GT
  • UGT1
  • Ugcgl1
  • Uggt
  • rUGT1
  • HUGT1
  • EMS-mutagenized bri1 suppressor 1
  • F3I17.13
  • F3I17_13
  • PRIORITY IN SWEET LIFE 2
  • PSL2
  • UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE
  • UGGT
  • UDP-glucose glycoprotein glucosyltransferase 1
  • UDP-glucose glycoprotein glucosyltransferase 1 L homeolog
  • UDP-glucose:glycoprotein glucosyltransferase 1
  • EMS-MUTAGENIZED BRI1 SUPPRESSOR 1
  • UGGT1
  • uggt1.L
  • uggt1
  • LOC100545947
  • Uggt1
  • EBS1
Reaktivität
Human, Maus, Ratte (Rattus)
37
10
9
1
1
Wirt
Kaninchen
37
1
Klonalität
Polyklonal
Konjugat
Dieser UGGT1 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
38
26
19
6
4
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere UGGT1 products on genomics-online (e.g. as negative or positive controls)
Andere Bezeichnung UGGT1 (UGGT1 Antibody Abstract)
Hintergrund Gene Symbol: UGGT1
Gen-ID 56886
Pathways Activation of Innate immune Response
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Western Blot: UGGT1 Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibrobla...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1) antibody (ABIN4364281) Immunohistochemistry-Paraffin: UGGT1 Antibody - Staining of human epididymis shows s...
Haben Sie etwas anderes gesucht?