TPPP2 Antikörper (Tubulin Polymerization Promoting Protein 2)

Details for Product anti-TPPP2 Antibody No. ABIN4361518, Anbieter: Anmelden zum Anzeigen
Antigen
  • RGD1566185
  • C14orf8
  • P18
  • p25beta
  • Gm1790
  • Gm77
  • tubulin polymerization-promoting protein family member 2
  • tubulin polymerization promoting protein family member 2
  • Tppp2
  • TPPP2
Reaktivität
Human
13
5
4
Wirt
Kaninchen
13
Klonalität
Polyklonal
Konjugat
Dieser TPPP2 Antikörper ist unkonjugiert
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
12
8
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMT
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere TPPP2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Andere Bezeichnung TPPP2 (TPPP2 Antibody Abstract)
Hintergrund Gene Symbol: TPPP2
Gen-ID 122664
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tubulin Polymerization Promoting Protein 2 (TPPP2) antibody (ABIN4361518) Immunohistochemistry-Paraffin: TPPP2 Antibody - Staining of human testis shows stron...
Western Blotting (WB) image for anti-Tubulin Polymerization Promoting Protein 2 (TPPP2) antibody (ABIN4361518) Western Blot: TPPP2 Antibody - Analysis in control (vector only transfected HEK293T ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Tubulin Polymerization Promoting Protein 2 (TPPP2) antibody (ABIN4361518) Immunohistochemistry-Paraffin: TPPP2 Antibody - Staining of human testis shows stron...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tubulin Polymerization Promoting Protein 2 (TPPP2) antibody (ABIN4361518) Immunohistochemistry-Paraffin: TPPP2 Antibody - Staining in human testis and prostat...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tubulin Polymerization Promoting Protein 2 (TPPP2) antibody (ABIN4361518) Immunohistochemistry-Paraffin: TPPP2 Antibody - Staining of human prostate shows low...
Haben Sie etwas anderes gesucht?