LAMTOR2 Antikörper (Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2)

Details for Product anti-LAMTOR2 Antibody No. ABIN4350844, Anbieter: Anmelden zum Anzeigen
Antigen
  • ENDAP
  • HSPC003
  • MAPBPIP
  • MAPKSP1AP
  • ROBLD3
  • Ragulator2
  • p14
  • 2010111E04Rik
  • AL022628
  • Mapbpip
  • P14
  • Rab25
  • Robld3
  • robld3
  • zgc:100811
  • mapbpip
  • RGD1562501
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • LAMTOR2
  • Lamtor2
  • lamtor2
Reaktivität
Human
38
20
18
Wirt
Kaninchen
38
Klonalität
Polyklonal
Konjugat
Dieser LAMTOR2 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
24
19
17
13
9
5
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere LAMTOR2 products on genomics-online (e.g. as negative or positive controls)
Andere Bezeichnung ROBLD3 (LAMTOR2 Antibody Abstract)
Hintergrund Gene Symbol: LAMTOR2
Gen-ID 28956
Pathways PI3K-Akt Signalweg
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-87951] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human stoma...
Western Blotting (WB) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Western Blot: ROBLD3 Antibody [NBP1-87951] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunohistochemistry-Paraffin: ROBLD3 Antibody [NBP1-87951] - Staining of human colon...
Immunofluorescence (IF) image for anti-Late Endosomal/lysosomal Adaptor, MAPK and MTOR Activator 2 (LAMTOR2) antibody (ABIN4350844) Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody - Immunofluorescent staining...
Haben Sie etwas anderes gesucht?