Renin Binding Protein (RENBP) Antikörper

Details zu Produkt Nr. ABIN4349989, Anbieter: Anmelden zum Anzeigen
Antigen
  • RENBP
  • MGC114748
  • wu:fc36a08
  • zgc:103475
  • RBP
  • RNBP
  • Age
  • Rnbp
  • AGE
  • RnBP
  • renin binding protein
  • renin binding protein L homeolog
  • N(alpha)-acetyltransferase 10, NatA catalytic subunit
  • RENBP
  • renbp.L
  • renbp
  • TVAG_270790
  • NAA10
  • Renbp
Reaktivität
Human, Maus, Ratte (Rattus)
29
19
18
3
2
2
2
1
1
1
Wirt
Kaninchen
27
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
16
13
4
3
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIA
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung RENBP (RENBP Antibody Abstract)
Hintergrund Gene Symbol: RENBP
Gen-ID 5973
Applikations-hinweise Western Blot 1:250 - 1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody [NBP1-80851] - Staining of human kidney...
Western Blotting (WB) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Western Blot: RENBP Antibody [NBP1-80851] - Lane 1: Mouse liver tissue lysate.Lane 2:...
Immunofluorescence (IF) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunocytochemistry/Immunofluorescence: RENBP Antibody [NBP1-80851] - staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Analysis in human spleen and liver t...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Staining of human liver shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Staining of human spleen shows high ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Staining of human liver shows low ex...
Western Blotting (WB) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Western Blot: RENBP Antibody - Analysis in human cell lines SK-MEL-30 and PC-3 using...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Staining of human spleen shows high ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Renin Binding Protein (RENBP) antibody (ABIN4349989) Immunohistochemistry-Paraffin: RENBP Antibody - Staining in human spleen and liver t...
Produkt verwendet in: Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011 (PubMed).

Haben Sie etwas anderes gesucht?