Metadherin (MTDH) Antikörper

Details zu Produkt Nr. ABIN4332036, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC75963
  • 2610103J23Rik
  • 3D3
  • 3D3/Lyric
  • AEG-1
  • AV353288
  • D8Bwg1112e
  • Lyric
  • AEG1
  • LYRIC
  • LYRIC/3D3
  • metadherin
  • mtdh
  • MTDH
  • Mtdh
Reaktivität
Human, Maus, Ratte (Rattus)
105
33
29
2
1
1
1
1
1
Wirt
Kaninchen
59
45
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
90
59
36
35
26
13
9
9
5
4
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Antigen Metadherin (MTDH)
Andere Bezeichnung LYRIC (MTDH Antibody Abstract)
Hintergrund Gene Symbol: MTDH
Gen-ID 92140
Pathways Cellular Response to Molecule of Bacterial Origin, Cell-Cell Junction Organization
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90328] - Staining of human cerebr...
Immunofluorescence (IF) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunocytochemistry/Immunofluorescence: LYRIC Antibody [NBP1-90328] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunohistochemistry-Paraffin: LYRIC Antibody - Staining of human small intestine sh...
Produkt verwendet in: Liu, Wu, Peng: "Astrocyte elevated gene-1 regulates osteosarcoma cell invasion and chemoresistance via endothelin-1/endothelin A receptor signaling." in: Oncology letters, Vol. 5, Issue 2, pp. 505-510, 2013 (PubMed).

Haben Sie etwas anderes gesucht?