LEPROTL1 Antikörper (Leptin Receptor Overlapping Transcript-Like 1)

Details for Product anti-LEPROTL1 Antibody No. ABIN4330690, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC53950
  • 1110067H13Rik
  • 1520402O14Rik
  • AI854296
  • HSPC112
  • Vps55
  • my047
  • leptin receptor overlapping transcript-like 1
  • leptin receptor overlapping transcript like 1 S homeolog
  • zgc:92045
  • leptin receptor overlapping transcript like 1
  • Leptin receptor overlapping transcript-like 1
  • Leprotl1
  • leprotl1.S
  • LEPROTL1
  • zgc:92045
  • leprotl1
  • lerl1
Reaktivität
Human
4
2
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
4
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GRLPFFSKMGTAESEGRETLTQQLPLPAAAMRRLLPASRVSTQPVLRLAD SAESLLGRPALWALGFLLCPPSQAQ
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere LEPROTL1 products on genomics-online (e.g. as negative or positive controls)
Antigen Leptin Receptor Overlapping Transcript-Like 1 (LEPROTL1)
Andere Bezeichnung LEPROTL1 (LEPROTL1 Antibody Abstract)
Hintergrund Gene Symbol: LEPROTL1
Gen-ID 23484
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leptin Receptor Overlapping Transcript-Like 1 (LEPROTL1) antibody (ABIN4330690) Immunohistochemistry-Paraffin: LEPROTL1 Antibody [NBP2-14626] - Staining of human col...
Haben Sie etwas anderes gesucht?