Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4319604, Anbieter: Anmelden zum Anzeigen
  • 2610510D13Rik
  • D10S102
  • HNRPA3
  • 2410013L13Rik
  • 2610209F03Rik
  • Hnrpa3
  • zgc:153703
  • DKFZp469I0118
  • heterogeneous nuclear ribonucleoprotein A3
  • heterogeneous nuclear ribonucleoprotein A3 S homeolog
  • heterogeneous nuclear ribonucleoprotein A1
  • hypothetical protein
  • Hnrnpa3
  • hnrnpa3.S
  • hnrnpa3
  • ARCVE_RS10260
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human HNRPA3. Peptide sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS.
Reinigung Protein A purified
Andere Bezeichnung HNRPA3 (HNRNPA3 Antibody Abstract)
Hintergrund Gene Symbol: HNRNPA3
Gen-ID 220988
NCBI Accession NP_919223
Forschungsgebiet DNA/RNA, Chromatin Binding Proteins, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against HNRPA3 and was validated on Western Blot and immunohistochemistry.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Immunohistochemistry: HNRPA3 Antibody [NBP1-80486] - Human Liver Cellular data: Hepat...
Western Blotting (WB) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Western Blot: HNRPA3 Antibody [NBP1-80486] - Jurkat cell lysate, Antibody Titration: ...
Western Blotting (WB) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Western Blot: HNRPA3 Antibody [NBP1-80486] - Antibody Titration: 1 ug/ml Human Daudi.
Western Blotting (WB) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Western Blot: HNRPA3 Antibody [NBP1-80486] - Antibody Titration: 1 ug/ml Human 721_B.
Western Blotting (WB) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Western Blot: HNRPA3 Antibody [NBP1-80486] - Sample Tissue: Jurkat, Lane A: Primary A...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Immunohistochemistry-Paraffin: HNRPA3 Antibody [NBP1-80486] - Human Liver Tissue, ant...
Western Blotting (WB) image for anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (ABIN4319604) Western Blot: HNRPA3 Antibody [NBP1-80486] - Sample Tissue: Human Jurkat Antibody Dil...
Haben Sie etwas anderes gesucht?