erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) Antikörper

Details zu Produkt Nr. ABIN4304861, Anbieter: Anmelden zum Anzeigen
  • MGC80597
  • MGC108072
  • EPB49
  • DMT
  • AI325486
  • Epb4.9
  • Epb49
  • dematin
  • dematin actin binding protein L homeolog
  • dematin actin binding protein
  • dmtn.L
  • DMTN
  • dmtn
  • Dmtn
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVVTNKGRTKLPP
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung Dematin (EPB49 Antibody Abstract)
Hintergrund Gene Symbol: EPB49
Gen-ID 2039
Pathways Regulation of Actin Filament Polymerization
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) antibody (ABIN4304861) Immunocytochemistry/Immunofluorescence: Dematin Antibody [NBP1-85007] Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-erythrocyte Membrane Protein Band 4.9 (Dematin) (EPB49) antibody (ABIN4304861) Immunohistochemistry-Paraffin: Dematin Antibody [NBP1-85007] - Immunohistochemical st...
Produkt verwendet in: Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Haben Sie etwas anderes gesucht?