Chimerin (Chimaerin) 2 (CHN2) Antikörper

Details zu Produkt Nr. ABIN4297936, Anbieter: Anmelden zum Anzeigen
Antigen
  • 1700026N20Rik
  • 4930557O16Rik
  • ARHGAP3
  • Bch
  • BCH
  • CHN2-3
  • RHOGAP3
  • chimerin 2
  • chimerin 2 L homeolog
  • chn2
  • CHN2
  • Chn2
  • chn2.L
Reaktivität
Human
53
16
12
6
4
4
4
3
2
1
1
Wirt
Kaninchen
39
16
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
3
3
3
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
38
33
7
5
3
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chimaerin 2 (CHN2 Antibody Abstract)
Hintergrund Gene Symbol: CHN2
Gen-ID 1124
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chimerin (Chimaerin) 2 (CHN2) antibody (ABIN4297936) Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP1-90108] - Staining of human ...
Immunofluorescence (IF) image for anti-Chimerin (Chimaerin) 2 (CHN2) antibody (ABIN4297936) Immunocytochemistry/Immunofluorescence: Chimaerin 2 Antibody [NBP1-90108] - Staining ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Chimerin (Chimaerin) 2 (CHN2) antibody (ABIN4297936) Immunohistochemistry-Paraffin: Chimaerin 2 Antibody - Staining of human duodenum sho...
Produkt verwendet in: Alvi, McArt, Kelly, Fuchs, Alderdice, McCabe, Bingham, McGready, Tripathi, Emmert-Streib, Loughrey, McQuaid, Maxwell, Hamilton, Turkington, James, Wilson, Salto-Tellez: "Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility." in: Oncotarget, Vol. 6, Issue 25, pp. 20863-74, 2015 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Haben Sie etwas anderes gesucht?