CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) Antikörper

Details zu Produkt Nr. ABIN4297064, Anbieter: Anmelden zum Anzeigen
Antigen
  • cdkrap3
  • fb33h04
  • fc09c05
  • id:ibd2920
  • wu:fb33h04
  • wu:fc09c05
  • zgc:86863
  • CDK5RAP3
  • cdk5rap3
  • MGC82350
  • C53
  • HSF-27
  • IC53
  • LZAP
  • MST016
  • OK/SW-cl.114
  • PP1553
  • 1810007E24Rik
  • BC002318
  • C81486
  • CDK5 regulatory subunit associated protein 3
  • CDK5 regulatory subunit associated protein 3 L homeolog
  • cdk5rap3
  • CDK5RAP3
  • cdk5rap3.L
  • Cdk5rap3
Reaktivität
Human, Maus, Ratte (Rattus)
48
30
30
4
2
1
1
1
1
Wirt
Kaninchen
44
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
34
17
16
13
10
5
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung CDK5RAP3 (CDK5RAP3 Antibody Abstract)
Hintergrund Gene Symbol: CDK5RAP3
Gen-ID 80279
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Immunohistochemistry-Paraffin: CDK5RAP3 Antibody [NBP1-86780] - Immunohistochemical s...
Western Blotting (WB) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Western Blot: CDK5RAP3 Antibody [NBP1-86780] - Lane 1: Marker [kDa] 230, 130, 95, 72,...
Western Blotting (WB) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Western Blot: CDK5RAP3 Antibody [NBP1-86780] - Lane 1: NIH-3T3 cell lysate (Mouse emb...
Western Blotting (WB) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Western Blot: CDK5RAP3 Antibody - Analysis in mouse cell line NIH-3T3 and rat cell l...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Immunohistochemistry-Paraffin: CDK5RAP3 Antibody - Staining of human epididymis show...
Immunofluorescence (IF) image for anti-CDK5 Regulatory Subunit Associated Protein 3 (CDK5RAP3) antibody (ABIN4297064) Immunocytochemistry/Immunofluorescence: CDK5RAP3 Antibody - Staining of human cell l...
Haben Sie etwas anderes gesucht?