C1GALT1-Specific Chaperone 1 (C1GALT1C1) Antikörper

Details zu Produkt Nr. ABIN4286174, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:66375
  • wu:fc17f08
  • wu:fc59b02
  • MGC88924
  • C1GALT2
  • C38H2-L1
  • COSMC
  • MST143
  • TNPS
  • 1500002I11Rik
  • AB030184
  • C1GalT2
  • C81205
  • Cosmc
  • RGD1311230
  • C1GALT1-specific chaperone 1
  • C1GALT1 specific chaperone 1
  • C1GALT1 specific chaperone 1 L homeolog
  • c1galt1c1
  • C1GALT1C1
  • c1galt1c1.L
  • C1galt1c1
Reaktivität
Human
18
9
8
1
1
1
1
1
Wirt
Kaninchen
15
3
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
17
7
6
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung C1GALT1C1 (C1GALT1C1 Antibody Abstract)
Hintergrund Gene Symbol: C1GALT1C1
Gen-ID 29071
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-C1GALT1-Specific Chaperone 1 (C1GALT1C1) antibody (ABIN4286174) Immunohistochemistry-Paraffin: C1GALT1C1 Antibody [NBP1-88478] - Staining of human li...
Immunofluorescence (IF) image for anti-C1GALT1-Specific Chaperone 1 (C1GALT1C1) antibody (ABIN4286174) Immunocytochemistry/Immunofluorescence: C1GALT1C1 Antibody [NBP1-88478] - Staining of...
Western Blotting (WB) image for anti-C1GALT1-Specific Chaperone 1 (C1GALT1C1) antibody (ABIN4286174) Western Blot: C1GALT1C1 Antibody [NBP1-88478] - Lane 1: Marker [kDa] 250, 130, 95, 72...
Haben Sie etwas anderes gesucht?