ATPase Inhibitory Factor 1 Antikörper (ATPIF1)

Details for Product anti-ATPIF1 Antibody No. ABIN4282372, Anbieter: Anmelden zum Anzeigen
  • ATPI
  • IP
  • ATPIF1
  • Atpi
  • If1
  • IF1PA
  • atpi
  • atpip
  • IF(1) A
  • IF1 A
  • atpif1
  • zgc:162207
  • IF(1)
  • IF1
  • ATPase inhibitory factor 1
  • ATPase inhibitory factor 1 L homeolog
  • ATPase inhibitory factor 1a
  • ATPase IV subunit
  • ATPIF1
  • Atpif1
  • atpif1.L
  • atpif1a
  • atpif1
  • LOC100360030
  • atpI
Dieser ATPase Inhibitory Factor 1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere ATPase Inhibitory Factor 1 products on genomics-online (e.g. as negative or positive controls)
Andere Bezeichnung ATPase Inhibitory Factor 1 (ATPIF1 Antibody Abstract)
Hintergrund Gene Symbol: ATPIF1
Gen-ID 93974
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ATPase Inhibitory Factor 1 (ATPIF1) antibody (ABIN4282372) Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Sta...
Immunofluorescence (IF) image for anti-ATPase Inhibitory Factor 1 (ATPIF1) antibody (ABIN4282372) Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP1-900...
Western Blotting (WB) image for anti-ATPase Inhibitory Factor 1 (ATPIF1) antibody (ABIN4282372) Western Blot: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Lane 1: Marker [kDa]...
Produkt verwendet in: Kampf, Bergman, Oksvold, Asplund, Navani, Wiking, Lundberg, Uhlén, Ponten: "A tool to facilitate clinical biomarker studies--a tissue dictionary based on the Human Protein Atlas." in: BMC medicine, Vol. 10, pp. 103, 2012 (PubMed).

Haben Sie etwas anderes gesucht?