ADP-Ribosylhydrolase Like 2 (ADPRHL2) Antikörper

Details zu Produkt Nr. ABIN4278516, Anbieter: Anmelden zum Anzeigen
  • ARH3
  • AI836109
  • Arh3
  • ADP-ribosylhydrolase like 2
  • Adprhl2
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Antigen ADP-Ribosylhydrolase Like 2 (ADPRHL2)
Andere Bezeichnung ADPRHL2 (ADPRHL2 Antibody Abstract)
Hintergrund Gene Symbol: ADPRHL2
Gen-ID 54936
UniProt Q9NX46
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-ADP-Ribosylhydrolase Like 2 (ADPRHL2) antibody (ABIN4278516) Western Blot: ADPRHL2 Antibody [NBP1-88834] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ADP-Ribosylhydrolase Like 2 (ADPRHL2) antibody (ABIN4278516) Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88834] - Staining of human panc...
Immunofluorescence (IF) image for anti-ADP-Ribosylhydrolase Like 2 (ADPRHL2) antibody (ABIN4278516) Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88834] - Staining of h...
Produkt verwendet in: Niere, Mashimo, Agledal, Dölle, Kasamatsu, Kato, Moss, Ziegler: "ADP-ribosylhydrolase 3 (ARH3), not poly(ADP-ribose) glycohydrolase (PARG) isoforms, is responsible for degradation of mitochondrial matrix-associated poly(ADP-ribose)." in: The Journal of biological chemistry, Vol. 287, Issue 20, pp. 16088-102, 2012 (PubMed).

Haben Sie etwas anderes gesucht?