ABCA5 Antikörper (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5)

Details for Product anti-ABCA5 Antibody No. ABIN4277159, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:163009
  • ABC13
  • EST90625
  • B930033A02Rik
  • mKIAA1888
  • ATP binding cassette subfamily A member 5
  • ATP-binding cassette, sub-family A (ABC1), member 5
  • ATP-binding cassette sub-family A member 5
  • ABCA5
  • abca5
  • LOC100545445
  • Abca5
Reaktivität
Human
45
16
13
3
2
2
1
1
Wirt
Kaninchen
34
14
Klonalität
Polyklonal
Konjugat
Dieser ABCA5 Antikörper ist unkonjugiert
2
2
2
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
29
23
19
9
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung ABCA5 (ABCA5 Antibody Abstract)
Hintergrund Gene Symbol: ABCA5
Gen-ID 23461
UniProt Q8WWZ7
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5) antibody (ABIN4277159) Immunohistochemistry: ABCA5 Antibody [NBP1-84780] - Staining of human colon shows str...
Haben Sie etwas anderes gesucht?