CYB5D1 Antikörper (Cytochrome B5 Domain Containing 1)

Details for Product anti-CYB5D1 Antibody No. ABIN4265595, Anbieter: Anmelden zum Anzeigen
  • RGD1559567
  • MGC146746
  • DKFZp459B103
  • Gm740
  • zgc:112008
  • cytochrome b5 domain containing 1
  • cytochrome b5 domain containing 1 L homeolog
  • Cyb5d1
  • cyb5d1.L
  • CYB5D1
  • cyb5d1
Dieser CYB5D1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CYB5D1(cytochrome b5 domain containing 1) The peptide sequence was selected from the middle region of CYB5D1. Peptide sequence KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CYB5D1
Hintergrund Gene Symbol: CYB5D1
Gen-ID 124637
UniProt Q6P9G0
Forschungsgebiet Cardiovascular
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CYB5D1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?