Platelet Factor 4 Variant 1 (PF4V1) Antikörper

Details zu Produkt Nr. ABIN4265399, Anbieter: Anmelden zum Anzeigen
  • PF4A
  • CXCL4L1
  • CXCL4V1
  • PF4-ALT
  • SCYB4V1
  • PF4V1
  • platelet factor 4 variant 1
  • PF4V1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to PF4V1(platelet factor 4 variant 1) The peptide sequence was selected from the middle region of PF4V1. Peptide sequence RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CXCL4L1 (PF4V1 Antibody Abstract)
Hintergrund Gene Symbol: PF4V1
Molekulargewicht Theoretical MW: 11 kDa
Gen-ID 5197
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PF4V1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?