CSNK1A1L Antikörper (Casein Kinase 1, alpha 1-Like)

Details for Product anti-CSNK1A1L Antibody No. ABIN4265160, Anbieter: Anmelden zum Anzeigen
  • CK1
  • casein kinase 1 alpha 1 like
  • casein kinase I isoform alpha-like
  • casein kinase I-like
  • casein kinase 1, alpha 1-like
  • CSNK1A1L
  • LOC100334765
  • LOC100356196
  • LOC100361046
  • LOC100378233
Dieser CSNK1A1L Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CSNK1A1LThe immunogen for this antibody is CSNK1A1L. Peptide sequence TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD.
Reinigung Immunogen affinity purified
Andere Bezeichnung CSNK1A1L (CSNK1A1L Antibody Abstract)
Hintergrund Gene Symbol: CSNK1A1L
Molekulargewicht Theoretical MW: 39 kDa
Gen-ID 122011
NCBI Accession NP_660204
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CSNK1A1L and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?