Crystallin, beta B3 (CRYbB3) Antikörper

Details zu Produkt Nr. ABIN4265140, Anbieter: Anmelden zum Anzeigen
  • MGC84109
  • CATCN2
  • CRYB3
  • CTRCT22
  • AI852419
  • crystallin beta B3 L homeolog
  • crystallin beta B3
  • crystallin, beta B3
  • crybb3.L
  • CRYBB3
  • crybb3
  • Crybb3
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CRYBB3(crystallin, beta B3) The peptide sequence was selected from the middle region of CRYBB3. Peptide sequence LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING.
Reinigung Immunogen affinity purified
Andere Bezeichnung CRYBB3 (CRYbB3 Antibody Abstract)
Hintergrund Gene Symbol: CRYBB3
Molekulargewicht Theoretical MW: 24 kDa
Gen-ID 1417
UniProt P26998
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CRYBB3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?