CREG1 Antikörper (Cellular Repressor of E1A-Stimulated Genes 1) (C-Term)

Details for Product anti-CREG1 Antibody No. ABIN4265047, Anbieter: Anmelden zum Anzeigen
  • CREG1
  • CREG
  • AA755314
  • Creg
  • cellular repressor of E1A stimulated genes 1
  • cellular repressor of E1A-stimulated genes 1
  • CREG1
  • creg1
  • Creg1
Dieser CREG1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is Creg1 - C-terminal region. Peptide sequence MMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CREG (CREG1 Antibody Abstract)
Hintergrund Gene Symbol: CREG1
Molekulargewicht Theoretical MW: 24 kDa
Gen-ID 8804
NCBI Accession NP_035934
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?