CRAT Antikörper (Carnitine O-Acetyltransferase) (N-Term)

Details for Product anti-CRAT Antibody No. ABIN4265004, Anbieter: Anmelden zum Anzeigen
  • AW107812
  • CAT1
  • carnitine O-acetyltransferase
  • carnitine acetyltransferase
  • Carnitine acetyltransferase
  • Carnitine acetyltransferase, putative
  • CRAT
  • CNA05200
  • CNL05760
  • CC1G_06292
  • PAS_chr3_0761
  • CGB_A5470W
  • CGB_D1240C
  • Crat
Dieser CRAT Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CRATThe immunogen for this antibody is CRAT. Peptide sequence MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD.
Reinigung Immunogen affinity purified
Andere Bezeichnung CRAT (CRAT Antibody Abstract)
Hintergrund Gene Symbol: CRAT
Molekulargewicht Theoretical MW: 51 kDa
Gen-ID 1384
Pathways Monocarboxylic Acid Catabolic Process
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CRAT and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1 mg/mL. Vortex followed by Centrifuge again to pellet the solution.
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Carnitine O-Acetyltransferase (CRAT) (N-Term) antibody (ABIN4265004) Western Blot: CRAT Antibody [NBP1-79532] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blotting (WB) image for anti-Carnitine O-Acetyltransferase (CRAT) (N-Term) antibody (ABIN4265004) Western Blot: CRAT Antibody [NBP1-79532] - Human HepG2, Liver, Testis Antibody Diluti...
Haben Sie etwas anderes gesucht?