Copine IV Antikörper (CPNE4) (C-Term)

Details for Product anti-CPNE4 Antibody No. ABIN4264939, Anbieter: Anmelden zum Anzeigen
  • CPNE4
  • COPN4
  • CPN4
  • 3632411M23Rik
  • 4933406O10Rik
  • si:dkey-5n4.1
  • copine 4
  • copine IV
  • copine IVb
  • CPNE4
  • cpne4
  • Cpne4
  • cpne4b
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CPNE4(copine IV) The peptide sequence was selected from the C terminal of CPNE4. Peptide sequence EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CPNE4 (CPNE4 Antibody Abstract)
Hintergrund Gene Symbol: CPNE4
Molekulargewicht Theoretical MW: 62 kDa
Gen-ID 131034
UniProt Q96A23
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CPNE4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?