Cytoplasmic Polyadenylated Homeobox (CPHX) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264930, Anbieter: Anmelden zum Anzeigen
  • AU019881
  • AU023336
  • C330003B14Rik
  • C80129
  • Cphx
  • Eso-1
  • cytoplasmic polyadenylated homeobox 1
  • Cphx1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Peptide sequence MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP. Accession: NP_780551
Reinigung Protein A purified
Andere Bezeichnung Cphx
Hintergrund Gene Symbol: C330003B14RIK
Molekulargewicht Theoretical MW: 22 kDa
Gen-ID 105594
UniProt Q8BX39
Applikations-hinweise Western Blot 1:1000This is a rabbit polyclonal antibody against C330003B14RIK and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?