COX7A1 Antikörper (Cytochrome C Oxidase Subunit VIIa Polypeptide 1 (Muscle)) (N-Term)

Details for Product anti-COX7A1 Antibody No. ABIN4264916, Anbieter: Anmelden zum Anzeigen
  • COX7A
  • COX7AH
  • COX7AM
  • COX
  • VIIa-M
  • cytochrome c oxidase polypeptide VIIa-muscle/heart
  • cytochrome c oxidase subunit VIIa 1
  • cytochrome c oxidase subunit 7A1
  • cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)
  • COX7A1
  • Cox7a1
Dieser COX7A1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is COX7A1 - N-terminal region. Peptide sequence: QALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTM
Reinigung Immunogen affinity purified
Andere Bezeichnung COX7A1 (COX7A1 Antibody Abstract)
Hintergrund Gene Symbol: COX7A1
Molekulargewicht Theoretical MW: 7 kDa
Gen-ID 1346
NCBI Accession NP_001855
Pathways Proton Transport
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?