Coatomer Protein Complex Subunit gamma 1 (COPg1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264879, Anbieter: Anmelden zum Anzeigen
  • COPG
  • COPG2
  • AU019265
  • BC056168
  • Copg
  • D6Ertd71e
  • D6Wsu16e
  • coatomer protein complex subunit gamma 1
  • coatomer protein complex, subunit gamma 1
  • COPG1
  • Copg1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to COPG (coatomer protein complex, subunit gamma) The peptide sequence was selected from the N terminal of COPG)(50ug). Peptide sequence MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK.
Reinigung Immunogen affinity purified
Andere Bezeichnung COPG (COPg1 Antibody Abstract)
Hintergrund Gene Symbol: COPG1
Gen-ID 22820
UniProt Q9Y678
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against COPG and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?