Gap Junction Protein, alpha 3, 46kDa (GJA3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264871, Anbieter: Anmelden zum Anzeigen
  • cx46
  • MGC53082
  • czp3
  • Cx44
  • cx48.5
  • Cnx46
  • Cx43
  • Cx46
  • Gja-3
  • CTRCT14
  • CX46
  • CZP3
  • MGC69466 protein L homeolog
  • gap junction protein alpha 3
  • gap junction protein, alpha 3
  • MGC69466.L
  • gja3
  • GJA3
  • Gja3
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to GJA3(gap junction protein, alpha 3, 46kDa) The peptide sequence was selected from the N terminal of GJA3. Peptide sequence ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS.
Reinigung Immunogen affinity purified
Andere Bezeichnung Connexin 46/GJA3 (GJA3 Antibody Abstract)
Hintergrund Gene Symbol: GJA3
Gen-ID 2700
UniProt Q9Y6H8
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GJA3 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?