GJB6 Antikörper (Gap Junction Protein, beta 6, 30kDa)

Details for Product anti-GJB6 Antibody No. ABIN4264859, Anbieter: Anmelden zum Anzeigen
  • connexin-26
  • cx26
  • cx30
  • dfna3
  • dfna3a
  • dfnb1
  • dfnb1a
  • ed2
  • edh
  • gjb6
  • hed
  • nsrd1
  • ppk
  • AA958971
  • Cx30
  • D14Bwg0506e
  • CX30
  • DFNA3
  • DFNA3B
  • DFNB1B
  • ECTD2
  • ED2
  • EDH
  • HED
  • HED2
  • CX31
  • connexin 30
  • gap junction protein beta 2
  • gap junction protein beta 6
  • gap junction protein, beta 6
  • LOC387566
  • gjb2
  • GJB6
  • Gjb6
Dieser GJB6 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
Reinigung Immunogen affinity purified
Andere Bezeichnung Connexin 30/GJB6 (GJB6 Antibody Abstract)
Hintergrund Gene Symbol: GJB6
Gen-ID 10804
UniProt O95452
Pathways Sensory Perception of Sound
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GJB6 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?