COL1A1 Antikörper (Collagen, Type I, alpha 1) (C-Term)

Details for Product anti-COL1A1 Antibody No. ABIN4264335, Anbieter: Anmelden zum Anzeigen
  • col1a1
  • MGC52532
  • COL1A1
  • COL1A2
  • OI4
  • Col1a-1
  • Cola-1
  • Cola1
  • Mov-13
  • Mov13
  • COLIA1
  • collagen, type I, alpha 1 S homeolog
  • collagen type I alpha 1 chain
  • collagen type I alpha 2 chain
  • collagen 1a1
  • collagen, type I, alpha 1
  • collagen alpha-1(I) chain
  • col1a1.S
  • COL1A1
  • COL1A2
  • col1a1
  • Col1a1
  • LOC397571
Dieser COL1A1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to COL1A1 (collagen, type I, alpha 1) The peptide sequence was selected from the C terminal of COL1A1. Peptide sequence YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC.
Reinigung Immunogen affinity purified
Andere Bezeichnung Collagen I alpha 1 (COL1A1 Antibody Abstract)
Hintergrund Gene Symbol: COL1A1
Molekulargewicht Theoretical MW: 139 kDa
Gen-ID 1277
UniProt P02452
Pathways Sensory Perception of Sound, Autophagie, Growth Factor Binding
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against COL1A1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?