CNNM4 Antikörper (Cyclin M4)

Details for Product anti-CNNM4 Antibody No. ABIN4264191, Anbieter: Anmelden zum Anzeigen
  • DKFZp468E0110
  • ACDP4
  • 5430430O18Rik
  • Acdp4
  • cyclin and CBS domain divalent metal cation transport mediator 4
  • cyclin M4
  • CNNM4
  • CpipJ_CPIJ006743
  • cnnm4
  • Cnnm4
Dieser CNNM4 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CNNM4(cyclin M4) The peptide sequence was selected from the middle region of CNNM4. Peptide sequence LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA.
Reinigung Immunogen affinity purified
Andere Bezeichnung CNNM4 (CNNM4 Antibody Abstract)
Hintergrund Gene Symbol: CNNM4
Gen-ID 26504
UniProt Q6P4Q7
Forschungsgebiet Signaling, Metabolism
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CNNM4 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?