Chromosome 16 Open Reading Frame 61 (C16orf61) Antikörper

Details zu Produkt Nr. ABIN4264156, Anbieter: Anmelden zum Anzeigen
  • 1110046L09Rik
  • 2310061C15Rik
  • DC13
  • C16orf61
  • C18H16orf61
  • si:busm1-241h12.4
  • si:dz241h12.4
  • zgc:92271
  • C-x(9)-C motif containing 2
  • C-x(9)-C motif containing 2 S homeolog
  • COX assembly mitochondrial protein 2
  • C-X9-C motif containing 2
  • cmc2
  • cmc2.S
  • CMC2
  • Cmc2
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to C16ORF61 The peptide sequence was selected from the middle region of C16orf61. Peptide sequence NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CMC2 (C16orf61 Antibody Abstract)
Hintergrund Gene Symbol: CMC2
Gen-ID 56942
UniProt Q9NRP2
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against C16orf61 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?